PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G1440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 187aa    MW: 21656.3 Da    PI: 8.7741
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G1440genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.79.2e-1279136562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  ++ rr+++NRe+ArrsR RK++ +e+L++ v  L  eN++L ++l+ l  ++  +k++
  Gh_A02G1440  79 RKRRRMISNRESARRSRMRKQKHLENLRNQVNRLRIENRELNNRLKFLLCHCHCVKTD 136
                  5789**************************************9999887777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-1072126No hitNo description
SMARTSM003386.6E-1375139IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.01377126IPR004827Basic-leucine zipper domain
PfamPF001704.8E-979135IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.77E-1179127No hitNo description
CDDcd147023.14E-2180131No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MLFTIPAGFS SDSMVDFDQF PGFETGFTPW DCSETFPPTT QSIEPAGSGS GSDETNQNQT  60
NSNSSLDQPN QLVSVIDERK RRRMISNRES ARRSRMRKQK HLENLRNQVN RLRIENRELN  120
NRLKFLLCHC HCVKTDNDRL RSEYSILRQK LSDIRQILLF KQLQQHSSAW PCYNVATMSD  180
QIPSLTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17882RKRRR
27899RKRRRMISNRESARRSRMRKQK
39198RRSRMRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5847425e-99JX584742.1 Gossypium hirsutum clone NBRI_GE18127 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469668.11e-132PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2QF141e-132A0A0D2QF14_G
STRINGVIT_00s0541g00020.t012e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.17e-29basic leucine-zipper 5